Placeholder image of a protein
Icon representing a puzzle

1409: Revisiting Puzzle 135: E. coli

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 8,926
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 8,922
  3. Avatar for Go Science 3. Go Science 58 pts. 8,906
  4. Avatar for Contenders 4. Contenders 43 pts. 8,889
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 8,855
  6. Avatar for Gargleblasters 6. Gargleblasters 22 pts. 8,833
  7. Avatar for Void Crushers 7. Void Crushers 15 pts. 8,828
  8. Avatar for HMT heritage 8. HMT heritage 11 pts. 8,825
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 7 pts. 8,789
  10. Avatar for GC Sommerlejr 2017 10. GC Sommerlejr 2017 5 pts. 8,643
  1. Avatar for johnmitch 31. johnmitch Lv 1 34 pts. 8,775
  2. Avatar for nicobul 32. nicobul Lv 1 32 pts. 8,770
  3. Avatar for kabubi 33. kabubi Lv 1 31 pts. 8,745
  4. Avatar for Blipperman 34. Blipperman Lv 1 30 pts. 8,738
  5. Avatar for Keresto 35. Keresto Lv 1 29 pts. 8,735
  6. Avatar for jausmh 36. jausmh Lv 1 28 pts. 8,730
  7. Avatar for WBarme1234 37. WBarme1234 Lv 1 26 pts. 8,729
  8. Avatar for phi16 38. phi16 Lv 1 25 pts. 8,713
  9. Avatar for NinjaGreg 39. NinjaGreg Lv 1 24 pts. 8,711
  10. Avatar for Deleted player 40. Deleted player pts. 8,699

Comments