Placeholder image of a protein
Icon representing a puzzle

1414: Unsolved De-novo 114

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
August 09, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEIDIQTQSKGHTRVRMRTEHSEWEITIRTTNEDELRERLRREFEKIKKEHDREEIKKELKKIEEEIQKQIE

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 2 pts. 9,024
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,820
  3. Avatar for Russian team 13. Russian team 1 pt. 8,640
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,520
  5. Avatar for Bad Monkey 15. Bad Monkey 1 pt. 8,458
  6. Avatar for freefolder 16. freefolder 1 pt. 7,736
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,263
  8. Avatar for BMCB 658 Summer 2017 18. BMCB 658 Summer 2017 1 pt. 6,531

  1. Avatar for tokens
    1. tokens Lv 1
    100 pts. 9,605
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 9,597
  3. Avatar for jermainiac 3. jermainiac Lv 1 94 pts. 9,557
  4. Avatar for markm457 4. markm457 Lv 1 91 pts. 9,516
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 88 pts. 9,498
  6. Avatar for Deleted player 6. Deleted player pts. 9,495
  7. Avatar for bertro 7. bertro Lv 1 82 pts. 9,478
  8. Avatar for ZeroLeak7 8. ZeroLeak7 Lv 1 80 pts. 9,469
  9. Avatar for Galaxie 9. Galaxie Lv 1 77 pts. 9,462
  10. Avatar for frood66 10. frood66 Lv 1 75 pts. 9,446

Comments


gitwut Lv 1

Client IRC rarely stays connected long enough to receive notifications. I received no notice for the expiration of puzzle 1412 nor for the opening of this one.

Please concentrate more on improving the player experience and less on useless new puzzle types that make it worse.