Placeholder image of a protein
Icon representing a puzzle

1414: Unsolved De-novo 114

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
August 09, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEIDIQTQSKGHTRVRMRTEHSEWEITIRTTNEDELRERLRREFEKIKKEHDREEIKKELKKIEEEIQKQIE

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 2 pts. 9,024
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,820
  3. Avatar for Russian team 13. Russian team 1 pt. 8,640
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,520
  5. Avatar for Bad Monkey 15. Bad Monkey 1 pt. 8,458
  6. Avatar for freefolder 16. freefolder 1 pt. 7,736
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,263
  8. Avatar for BMCB 658 Summer 2017 18. BMCB 658 Summer 2017 1 pt. 6,531
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 0
  1. Avatar for ciberhunter 91. ciberhunter Lv 1 2 pts. 8,640
  2. Avatar for FishKAA 92. FishKAA Lv 1 2 pts. 8,638
  3. Avatar for Vincera 93. Vincera Lv 1 2 pts. 8,610
  4. Avatar for makeitwork 94. makeitwork Lv 1 1 pt. 8,607
  5. Avatar for pfirth 95. pfirth Lv 1 1 pt. 8,599
  6. Avatar for tomespen 96. tomespen Lv 1 1 pt. 8,581
  7. Avatar for leehaggis 97. leehaggis Lv 1 1 pt. 8,537
  8. Avatar for jausmh 98. jausmh Lv 1 1 pt. 8,534
  9. Avatar for Savas 99. Savas Lv 1 1 pt. 8,520
  10. Avatar for hpaege 100. hpaege Lv 1 1 pt. 8,480

Comments

gitwut Lv 1

Client IRC rarely stays connected long enough to receive notifications. I received no notice for the expiration of puzzle 1412 nor for the opening of this one.

Please concentrate more on improving the player experience and less on useless new puzzle types that make it worse.