Placeholder image of a protein
Icon representing a puzzle

1414: Unsolved De-novo 114

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
August 09, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEIDIQTQSKGHTRVRMRTEHSEWEITIRTTNEDELRERLRREFEKIKKEHDREEIKKELKKIEEEIQKQIE

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 2 pts. 9,024
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,820
  3. Avatar for Russian team 13. Russian team 1 pt. 8,640
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,520
  5. Avatar for Bad Monkey 15. Bad Monkey 1 pt. 8,458
  6. Avatar for freefolder 16. freefolder 1 pt. 7,736
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,263
  8. Avatar for BMCB 658 Summer 2017 18. BMCB 658 Summer 2017 1 pt. 6,531
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 0
  1. Avatar for Mao Mao 121. Mao Mao Lv 1 1 pt. 7,883
  2. Avatar for Jaco van As 122. Jaco van As Lv 1 1 pt. 7,840
  3. Avatar for parsnip 123. parsnip Lv 1 1 pt. 7,741
  4. Avatar for Imeturoran 124. Imeturoran Lv 1 1 pt. 7,736
  5. Avatar for JUMELLE54 125. JUMELLE54 Lv 1 1 pt. 7,710
  6. Avatar for pandapharmd 126. pandapharmd Lv 1 1 pt. 7,576
  7. Avatar for nikokiki 127. nikokiki Lv 1 1 pt. 7,494
  8. Avatar for andrewxc 128. andrewxc Lv 1 1 pt. 7,478
  9. Avatar for Mitzi13 129. Mitzi13 Lv 1 1 pt. 7,466
  10. Avatar for mirjamvandelft 130. mirjamvandelft Lv 1 1 pt. 7,460

Comments

gitwut Lv 1

Client IRC rarely stays connected long enough to receive notifications. I received no notice for the expiration of puzzle 1412 nor for the opening of this one.

Please concentrate more on improving the player experience and less on useless new puzzle types that make it worse.