Placeholder image of a protein
Icon representing a puzzle

1414: Unsolved De-novo 114

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 09, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEIDIQTQSKGHTRVRMRTEHSEWEITIRTTNEDELRERLRREFEKIKKEHDREEIKKELKKIEEEIQKQIE

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 2 pts. 9,024
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,820
  3. Avatar for Russian team 13. Russian team 1 pt. 8,640
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,520
  5. Avatar for Bad Monkey 15. Bad Monkey 1 pt. 8,458
  6. Avatar for freefolder 16. freefolder 1 pt. 7,736
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,263
  8. Avatar for BMCB 658 Summer 2017 18. BMCB 658 Summer 2017 1 pt. 6,531

  1. Avatar for christioanchauvin 31. christioanchauvin Lv 1 34 pts. 9,292
  2. Avatar for crpainter 32. crpainter Lv 1 33 pts. 9,287
  3. Avatar for Glen B 33. Glen B Lv 1 32 pts. 9,284
  4. Avatar for isaksson 34. isaksson Lv 1 30 pts. 9,276
  5. Avatar for Skippysk8s 35. Skippysk8s Lv 1 29 pts. 9,262
  6. Avatar for NinjaGreg 36. NinjaGreg Lv 1 28 pts. 9,262
  7. Avatar for Vinara 37. Vinara Lv 1 27 pts. 9,256
  8. Avatar for anthion 38. anthion Lv 1 26 pts. 9,245
  9. Avatar for alwen 39. alwen Lv 1 25 pts. 9,243
  10. Avatar for Blipperman 40. Blipperman Lv 1 24 pts. 9,231

Comments


gitwut Lv 1

Client IRC rarely stays connected long enough to receive notifications. I received no notice for the expiration of puzzle 1412 nor for the opening of this one.

Please concentrate more on improving the player experience and less on useless new puzzle types that make it worse.