Placeholder image of a protein
Icon representing a puzzle

1414: Unsolved De-novo 114

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
August 09, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEIDIQTQSKGHTRVRMRTEHSEWEITIRTTNEDELRERLRREFEKIKKEHDREEIKKELKKIEEEIQKQIE

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 2 pts. 9,024
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,820
  3. Avatar for Russian team 13. Russian team 1 pt. 8,640
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,520
  5. Avatar for Bad Monkey 15. Bad Monkey 1 pt. 8,458
  6. Avatar for freefolder 16. freefolder 1 pt. 7,736
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,263
  8. Avatar for BMCB 658 Summer 2017 18. BMCB 658 Summer 2017 1 pt. 6,531
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 0
  1. Avatar for benrh 61. benrh Lv 1 9 pts. 9,039
  2. Avatar for pvc78 62. pvc78 Lv 1 9 pts. 9,036
  3. Avatar for YeshuaLives 63. YeshuaLives Lv 1 8 pts. 9,035
  4. Avatar for andrewtmaxwell 64. andrewtmaxwell Lv 1 8 pts. 9,030
  5. Avatar for Mr_Jolty 65. Mr_Jolty Lv 1 7 pts. 9,024
  6. Avatar for georg137 66. georg137 Lv 1 7 pts. 9,017
  7. Avatar for harvardman 67. harvardman Lv 1 7 pts. 8,978
  8. Avatar for tony46 68. tony46 Lv 1 6 pts. 8,970
  9. Avatar for Fog Darts 69. Fog Darts Lv 1 6 pts. 8,966
  10. Avatar for stomjoh 70. stomjoh Lv 1 6 pts. 8,959

Comments

gitwut Lv 1

Client IRC rarely stays connected long enough to receive notifications. I received no notice for the expiration of puzzle 1412 nor for the opening of this one.

Please concentrate more on improving the player experience and less on useless new puzzle types that make it worse.