Placeholder image of a protein
Icon representing a puzzle

1414: Unsolved De-novo 114

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
August 09, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEIDIQTQSKGHTRVRMRTEHSEWEITIRTTNEDELRERLRREFEKIKKEHDREEIKKELKKIEEEIQKQIE

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 2 pts. 9,024
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,820
  3. Avatar for Russian team 13. Russian team 1 pt. 8,640
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,520
  5. Avatar for Bad Monkey 15. Bad Monkey 1 pt. 8,458
  6. Avatar for freefolder 16. freefolder 1 pt. 7,736
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,263
  8. Avatar for BMCB 658 Summer 2017 18. BMCB 658 Summer 2017 1 pt. 6,531
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 0
  1. Avatar for SKSbell 71. SKSbell Lv 1 5 pts. 8,946
  2. Avatar for dizzywings 72. dizzywings Lv 1 5 pts. 8,941
  3. Avatar for alcor29 73. alcor29 Lv 1 5 pts. 8,927
  4. Avatar for tamanrasset 74. tamanrasset Lv 1 5 pts. 8,923
  5. Avatar for Mydogisa Toelicker 75. Mydogisa Toelicker Lv 1 4 pts. 8,912
  6. Avatar for Toudi_Ogr 76. Toudi_Ogr Lv 1 4 pts. 8,898
  7. Avatar for Festering Wounds 77. Festering Wounds Lv 1 4 pts. 8,873
  8. Avatar for snakeguy 78. snakeguy Lv 1 4 pts. 8,869
  9. Avatar for DoctorSockrates 79. DoctorSockrates Lv 1 3 pts. 8,862
  10. Avatar for YGK 80. YGK Lv 1 3 pts. 8,851

Comments

gitwut Lv 1

Client IRC rarely stays connected long enough to receive notifications. I received no notice for the expiration of puzzle 1412 nor for the opening of this one.

Please concentrate more on improving the player experience and less on useless new puzzle types that make it worse.