Placeholder image of a protein
Icon representing a puzzle

1414: Unsolved De-novo 114

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
August 09, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEIDIQTQSKGHTRVRMRTEHSEWEITIRTTNEDELRERLRREFEKIKKEHDREEIKKELKKIEEEIQKQIE

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 2 pts. 9,024
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,820
  3. Avatar for Russian team 13. Russian team 1 pt. 8,640
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,520
  5. Avatar for Bad Monkey 15. Bad Monkey 1 pt. 8,458
  6. Avatar for freefolder 16. freefolder 1 pt. 7,736
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,263
  8. Avatar for BMCB 658 Summer 2017 18. BMCB 658 Summer 2017 1 pt. 6,531

  1. Avatar for fpc 81. fpc Lv 1 3 pts. 8,825
  2. Avatar for deLaCeiba 82. deLaCeiba Lv 1 3 pts. 8,820
  3. Avatar for MicElephant 83. MicElephant Lv 1 3 pts. 8,772
  4. Avatar for hada 84. hada Lv 1 3 pts. 8,752
  5. Avatar for Squirrely 85. Squirrely Lv 1 2 pts. 8,751
  6. Avatar for carsonfb 86. carsonfb Lv 1 2 pts. 8,719
  7. Avatar for fishercat 87. fishercat Lv 1 2 pts. 8,712
  8. Avatar for Iron pet 88. Iron pet Lv 1 2 pts. 8,705
  9. Avatar for mitarcher 89. mitarcher Lv 1 2 pts. 8,694
  10. Avatar for NerdPreferred 90. NerdPreferred Lv 1 2 pts. 8,662

Comments


gitwut Lv 1

Client IRC rarely stays connected long enough to receive notifications. I received no notice for the expiration of puzzle 1412 nor for the opening of this one.

Please concentrate more on improving the player experience and less on useless new puzzle types that make it worse.