Placeholder image of a protein
Icon representing a puzzle

1414: Unsolved De-novo 114

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
August 09, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEIDIQTQSKGHTRVRMRTEHSEWEITIRTTNEDELRERLRREFEKIKKEHDREEIKKELKKIEEEIQKQIE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,608
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,597
  3. Avatar for Go Science 3. Go Science 56 pts. 9,469
  4. Avatar for Marvin's bunch 4. Marvin's bunch 41 pts. 9,446
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 9,439
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,428
  7. Avatar for Contenders 7. Contenders 14 pts. 9,366
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,330
  9. Avatar for xkcd 9. xkcd 6 pts. 9,177
  10. Avatar for Deleted group 10. Deleted group pts. 9,058

  1. Avatar for fpc 81. fpc Lv 1 3 pts. 8,825
  2. Avatar for deLaCeiba 82. deLaCeiba Lv 1 3 pts. 8,820
  3. Avatar for MicElephant 83. MicElephant Lv 1 3 pts. 8,772
  4. Avatar for hada 84. hada Lv 1 3 pts. 8,752
  5. Avatar for Squirrely 85. Squirrely Lv 1 2 pts. 8,751
  6. Avatar for carsonfb 86. carsonfb Lv 1 2 pts. 8,719
  7. Avatar for fishercat 87. fishercat Lv 1 2 pts. 8,712
  8. Avatar for Iron pet 88. Iron pet Lv 1 2 pts. 8,705
  9. Avatar for mitarcher 89. mitarcher Lv 1 2 pts. 8,694
  10. Avatar for NerdPreferred 90. NerdPreferred Lv 1 2 pts. 8,662

Comments


gitwut Lv 1

Client IRC rarely stays connected long enough to receive notifications. I received no notice for the expiration of puzzle 1412 nor for the opening of this one.

Please concentrate more on improving the player experience and less on useless new puzzle types that make it worse.