Placeholder image of a protein
Icon representing a puzzle

1414: Unsolved De-novo 114

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 09, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEIDIQTQSKGHTRVRMRTEHSEWEITIRTTNEDELRERLRREFEKIKKEHDREEIKKELKKIEEEIQKQIE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,608
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,597
  3. Avatar for Go Science 3. Go Science 56 pts. 9,469
  4. Avatar for Marvin's bunch 4. Marvin's bunch 41 pts. 9,446
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 9,439
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,428
  7. Avatar for Contenders 7. Contenders 14 pts. 9,366
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,330
  9. Avatar for xkcd 9. xkcd 6 pts. 9,177
  10. Avatar for Deleted group 10. Deleted group pts. 9,058

  1. Avatar for ncc17001 141. ncc17001 Lv 1 1 pt. 6,508
  2. Avatar for wolfshape 142. wolfshape Lv 1 1 pt. 6,474
  3. Avatar for AgentIMW 143. AgentIMW Lv 1 1 pt. 6,466
  4. Avatar for larry25427 144. larry25427 Lv 1 1 pt. 6,463
  5. Avatar for rainbow_star_tea 145. rainbow_star_tea Lv 1 1 pt. 6,334
  6. Avatar for bullmoose3 146. bullmoose3 Lv 1 1 pt. 6,281
  7. Avatar for sasha5 147. sasha5 Lv 1 1 pt. 6,189
  8. Avatar for _Cyber_ 148. _Cyber_ Lv 1 1 pt. 5,704
  9. Avatar for heyubob 149. heyubob Lv 1 1 pt. 0
  10. Avatar for lilovip 150. lilovip Lv 1 1 pt. 0

Comments


gitwut Lv 1

Client IRC rarely stays connected long enough to receive notifications. I received no notice for the expiration of puzzle 1412 nor for the opening of this one.

Please concentrate more on improving the player experience and less on useless new puzzle types that make it worse.