Placeholder image of a protein
Icon representing a puzzle

1418: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 17, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 9,508
  2. Avatar for xkcd 12. xkcd 1 pt. 9,401
  3. Avatar for freefolder 13. freefolder 1 pt. 9,393
  4. Avatar for Deleted group 14. Deleted group pts. 9,288
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,124

  1. Avatar for Enzyme
    1. Enzyme Lv 1
    100 pts. 10,025
  2. Avatar for gitwut 2. gitwut Lv 1 97 pts. 10,016
  3. Avatar for frood66 3. frood66 Lv 1 94 pts. 9,963
  4. Avatar for nicobul 4. nicobul Lv 1 91 pts. 9,897
  5. Avatar for gmn 5. gmn Lv 1 88 pts. 9,884
  6. Avatar for christioanchauvin 6. christioanchauvin Lv 1 85 pts. 9,866
  7. Avatar for dizzywings 7. dizzywings Lv 1 82 pts. 9,863
  8. Avatar for johnmitch 8. johnmitch Lv 1 79 pts. 9,863
  9. Avatar for LociOiling 9. LociOiling Lv 1 76 pts. 9,861
  10. Avatar for mimi 10. mimi Lv 1 74 pts. 9,859

Comments