Placeholder image of a protein
Icon representing a puzzle

1420: Unsolved De-novo Freestyle 116

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
August 20, 2017
Expires
Max points
100
Description

Note: Due to scoreboard instabilities, the deadline for this puzzle has been extended 24 hours, to August 30 at 23:00 UTC.



The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MVNEFHGREFQCAQYVPSGPGYENISRSNQVCTAVGSVPGNEMVSGTNYLAGAYQYYNSHKW

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,221
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,001
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 7,951
  4. Avatar for freefolder 14. freefolder 1 pt. 7,826
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 7,787
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 5,885

  1. Avatar for trentis1 111. trentis1 Lv 1 1 pt. 7,693
  2. Avatar for multaq 112. multaq Lv 1 1 pt. 7,636
  3. Avatar for BD AP-bio 113. BD AP-bio Lv 1 1 pt. 7,629
  4. Avatar for mccaron 114. mccaron Lv 1 1 pt. 7,629
  5. Avatar for Deleted player 115. Deleted player pts. 7,626
  6. Avatar for mcatneuro1 116. mcatneuro1 Lv 1 1 pt. 7,618
  7. Avatar for Yekoss 117. Yekoss Lv 1 1 pt. 7,597
  8. Avatar for Lejacques 118. Lejacques Lv 1 1 pt. 7,571
  9. Avatar for justjustin 119. justjustin Lv 1 1 pt. 7,551
  10. Avatar for Fowardint 120. Fowardint Lv 1 1 pt. 7,539

Comments


LociOiling Lv 1

The Foldit team has extended the expiration of this puzzle by 24 hours due to problems with in-game scoreboards not updating.

See my forum post describing the issues:

http://fold.it/portal/node/2004117

The scoreboards appear to be working again, but this was the second time the issue struck in only a few days.

You may see "rank down" messages in your Foldit game clients when the scoreboards start getting updated….