Placeholder image of a protein
Icon representing a puzzle

1420: Unsolved De-novo Freestyle 116

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
August 20, 2017
Expires
Max points
100
Description

Note: Due to scoreboard instabilities, the deadline for this puzzle has been extended 24 hours, to August 30 at 23:00 UTC.



The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MVNEFHGREFQCAQYVPSGPGYENISRSNQVCTAVGSVPGNEMVSGTNYLAGAYQYYNSHKW

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,221
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,001
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 7,951
  4. Avatar for freefolder 14. freefolder 1 pt. 7,826
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 7,787
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 5,885
  1. Avatar for nanu_manu 131. nanu_manu Lv 1 1 pt. 7,021
  2. Avatar for srijken 132. srijken Lv 1 1 pt. 6,998
  3. Avatar for Bautho 133. Bautho Lv 1 1 pt. 6,979
  4. Avatar for nicksisco 134. nicksisco Lv 1 1 pt. 6,927
  5. Avatar for schntgaispock 135. schntgaispock Lv 1 1 pt. 6,748
  6. Avatar for nth_synthetic 136. nth_synthetic Lv 1 1 pt. 6,688
  7. Avatar for merlel 137. merlel Lv 1 1 pt. 6,666
  8. Avatar for Andrudja 138. Andrudja Lv 1 1 pt. 6,649
  9. Avatar for gurch 139. gurch Lv 1 1 pt. 6,611
  10. Avatar for pandapharmd 140. pandapharmd Lv 1 1 pt. 6,585

Comments

LociOiling Lv 1

The Foldit team has extended the expiration of this puzzle by 24 hours due to problems with in-game scoreboards not updating.

See my forum post describing the issues:

http://fold.it/portal/node/2004117

The scoreboards appear to be working again, but this was the second time the issue struck in only a few days.

You may see "rank down" messages in your Foldit game clients when the scoreboards start getting updated….