Placeholder image of a protein
Icon representing a puzzle

1420: Unsolved De-novo Freestyle 116

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
August 20, 2017
Expires
Max points
100
Description

Note: Due to scoreboard instabilities, the deadline for this puzzle has been extended 24 hours, to August 30 at 23:00 UTC.



The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MVNEFHGREFQCAQYVPSGPGYENISRSNQVCTAVGSVPGNEMVSGTNYLAGAYQYYNSHKW

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,221
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,001
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 7,951
  4. Avatar for freefolder 14. freefolder 1 pt. 7,826
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 7,787
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 5,885

  1. Avatar for tomespen 141. tomespen Lv 1 1 pt. 6,413
  2. Avatar for altejoh 142. altejoh Lv 1 1 pt. 6,408
  3. Avatar for juwero 143. juwero Lv 1 1 pt. 6,388
  4. Avatar for Museka 144. Museka Lv 1 1 pt. 6,133
  5. Avatar for aspadistra 145. aspadistra Lv 1 1 pt. 5,885
  6. Avatar for Carwash17170 146. Carwash17170 Lv 1 1 pt. 5,644
  7. Avatar for herbalcheese 147. herbalcheese Lv 1 1 pt. 5,583
  8. Avatar for 01010011111 148. 01010011111 Lv 1 1 pt. 5,556
  9. Avatar for ZeroLeak7 149. ZeroLeak7 Lv 1 1 pt. 5,220
  10. Avatar for randcvn 150. randcvn Lv 1 1 pt. 0

Comments


LociOiling Lv 1

The Foldit team has extended the expiration of this puzzle by 24 hours due to problems with in-game scoreboards not updating.

See my forum post describing the issues:

http://fold.it/portal/node/2004117

The scoreboards appear to be working again, but this was the second time the issue struck in only a few days.

You may see "rank down" messages in your Foldit game clients when the scoreboards start getting updated….