Placeholder image of a protein
Icon representing a puzzle

1420: Unsolved De-novo Freestyle 116

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
August 20, 2017
Expires
Max points
100
Description

Note: Due to scoreboard instabilities, the deadline for this puzzle has been extended 24 hours, to August 30 at 23:00 UTC.



The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MVNEFHGREFQCAQYVPSGPGYENISRSNQVCTAVGSVPGNEMVSGTNYLAGAYQYYNSHKW

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,221
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,001
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 7,951
  4. Avatar for freefolder 14. freefolder 1 pt. 7,826
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 7,787
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 5,885
  1. Avatar for actiasluna 11. actiasluna Lv 1 72 pts. 8,571
  2. Avatar for dcrwheeler 12. dcrwheeler Lv 1 70 pts. 8,569
  3. Avatar for Bruno Kestemont 13. Bruno Kestemont Lv 1 67 pts. 8,566
  4. Avatar for eusair 14. eusair Lv 1 65 pts. 8,550
  5. Avatar for johnmitch 15. johnmitch Lv 1 63 pts. 8,546
  6. Avatar for frood66 16. frood66 Lv 1 61 pts. 8,544
  7. Avatar for bertro 17. bertro Lv 1 58 pts. 8,525
  8. Avatar for gmn 18. gmn Lv 1 56 pts. 8,525
  9. Avatar for Vincera 19. Vincera Lv 1 54 pts. 8,524
  10. Avatar for fiendish_ghoul 20. fiendish_ghoul Lv 1 53 pts. 8,522

Comments

LociOiling Lv 1

The Foldit team has extended the expiration of this puzzle by 24 hours due to problems with in-game scoreboards not updating.

See my forum post describing the issues:

http://fold.it/portal/node/2004117

The scoreboards appear to be working again, but this was the second time the issue struck in only a few days.

You may see "rank down" messages in your Foldit game clients when the scoreboards start getting updated….