Placeholder image of a protein
Icon representing a puzzle

1420: Unsolved De-novo Freestyle 116

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
August 20, 2017
Expires
Max points
100
Description

Note: Due to scoreboard instabilities, the deadline for this puzzle has been extended 24 hours, to August 30 at 23:00 UTC.



The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MVNEFHGREFQCAQYVPSGPGYENISRSNQVCTAVGSVPGNEMVSGTNYLAGAYQYYNSHKW

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,221
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,001
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 7,951
  4. Avatar for freefolder 14. freefolder 1 pt. 7,826
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 7,787
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 5,885

  1. Avatar for isaksson 51. isaksson Lv 1 15 pts. 8,285
  2. Avatar for andrewxc 52. andrewxc Lv 1 14 pts. 8,285
  3. Avatar for fryguy 53. fryguy Lv 1 13 pts. 8,283
  4. Avatar for xabxs 54. xabxs Lv 1 13 pts. 8,268
  5. Avatar for Anfinsen_slept_here 55. Anfinsen_slept_here Lv 1 12 pts. 8,260
  6. Avatar for diamonddays 56. diamonddays Lv 1 12 pts. 8,259
  7. Avatar for SWR_DMaster 57. SWR_DMaster Lv 1 11 pts. 8,254
  8. Avatar for Ikuso 58. Ikuso Lv 1 11 pts. 8,248
  9. Avatar for NinjaGreg 59. NinjaGreg Lv 1 10 pts. 8,239
  10. Avatar for drumpeter18yrs9yrs 60. drumpeter18yrs9yrs Lv 1 10 pts. 8,221

Comments


LociOiling Lv 1

The Foldit team has extended the expiration of this puzzle by 24 hours due to problems with in-game scoreboards not updating.

See my forum post describing the issues:

http://fold.it/portal/node/2004117

The scoreboards appear to be working again, but this was the second time the issue struck in only a few days.

You may see "rank down" messages in your Foldit game clients when the scoreboards start getting updated….