Placeholder image of a protein
Icon representing a puzzle

1420: Unsolved De-novo Freestyle 116

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
August 20, 2017
Expires
Max points
100
Description

Note: Due to scoreboard instabilities, the deadline for this puzzle has been extended 24 hours, to August 30 at 23:00 UTC.



The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MVNEFHGREFQCAQYVPSGPGYENISRSNQVCTAVGSVPGNEMVSGTNYLAGAYQYYNSHKW

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 8,685
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 8,661
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 8,650
  4. Avatar for Contenders 4. Contenders 33 pts. 8,636
  5. Avatar for Go Science 5. Go Science 22 pts. 8,627
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 8,563
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 8,467
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 8,447
  9. Avatar for xkcd 9. xkcd 3 pts. 8,283
  10. Avatar for Kotocycle 10. Kotocycle 2 pts. 8,248
  1. Avatar for Lucas1234 151. Lucas1234 Lv 1 1 pt. 0
  2. Avatar for fbanaudi 152. fbanaudi Lv 1 1 pt. 0
  3. Avatar for dettingen 153. dettingen Lv 1 1 pt. 0
  4. Avatar for SaraL 154. SaraL Lv 1 1 pt. 0
  5. Avatar for gdnskye 155. gdnskye Lv 1 1 pt. 0
  6. Avatar for Hollinas 156. Hollinas Lv 1 1 pt. 0

Comments

LociOiling Lv 1

The Foldit team has extended the expiration of this puzzle by 24 hours due to problems with in-game scoreboards not updating.

See my forum post describing the issues:

http://fold.it/portal/node/2004117

The scoreboards appear to be working again, but this was the second time the issue struck in only a few days.

You may see "rank down" messages in your Foldit game clients when the scoreboards start getting updated….