Placeholder image of a protein
Icon representing a puzzle

1423: Unsolved De-novo Freestyle 116: Predicted Contacts

Closed since over 8 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
August 31, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1420, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1420 and use them as a starting point here.



Sequence:


MVNEFHGREFQCAQYVPSGPGYENISRSNQVCTAVGSVPGNEMVSGTNYLAGAYQYYNSHKW

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 3 pts. 8,948
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 8,714
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,628
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 7,411
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 7,048
  6. Avatar for CH4110 Fold it! 16. CH4110 Fold it! 1 pt. 7,001
  7. Avatar for CureCoin 17. CureCoin 1 pt. 5,823
  8. Avatar for St Pat's Biology 203 18. St Pat's Biology 203 1 pt. 5,758
  9. Avatar for Russian team 19. Russian team 1 pt. 5,288
  10. Avatar for Window Group 20. Window Group 1 pt. 0

  1. Avatar for actiasluna
    1. actiasluna Lv 1
    100 pts. 10,408
  2. Avatar for Susume 2. Susume Lv 1 97 pts. 10,389
  3. Avatar for tokens 3. tokens Lv 1 94 pts. 10,371
  4. Avatar for Galaxie 4. Galaxie Lv 1 92 pts. 10,326
  5. Avatar for Blipperman 5. Blipperman Lv 1 89 pts. 10,283
  6. Avatar for bertro 6. bertro Lv 1 86 pts. 10,269
  7. Avatar for grogar7 7. grogar7 Lv 1 83 pts. 10,242
  8. Avatar for eusair 8. eusair Lv 1 81 pts. 10,239
  9. Avatar for markm457 9. markm457 Lv 1 78 pts. 10,219
  10. Avatar for retiredmichael 10. retiredmichael Lv 1 76 pts. 10,154

Comments


bkoep Staff Lv 1

Definitely haven't seen that before. Has this happened again? Do you remember what you were doing when the map shrunk?

toshiue Lv 1

Was asking myself the same question when I first noticed it. Had been manually picking contacts for some time, then just noticed the edges were missing. No fireworks, just normal one minute and truncated the next. Closing and restarting the client seems to have fixed it (closing/stretching the contact map window had no affect), hasn't re-appeared and is about 500 points on down the line since it happened. Generic weirdness, best guess.

Susume Lv 1

The map can be zoomed, using whatever your computer's zoom control is. I wonder if you somehow zoomed in on it. That makes the edges disappear.

jeff101 Lv 1

I have a different problem on one client:

I made the contact map so tall that the thin bar at its bottom edge that lets you adjust the map's height is no longer clickable. Now I can't seem to shrink this contact map. Not a big problem, but it would be better if it didn't happen.

LociOiling Lv 1

To expand on susume's answer to toshiue, the mouse wheel zooms the contact map in or out.

When the contact map window gets "wedged", as jeff101 describes, the resize bar is no longer visible. Restarting the client seems to work in this case. After the restart, the contact map starts at a smaller size.

On some systems, you may be able to flip the display, which is another way to resize the window with restarting the client.

For example, on my Thinkpad laptop, ctrl+alt+left arrow flips the display to the top is on the left of the screen. With this tall thin view, it's easy to resize the contact map. Hitting ctrl+alt+up arrow returns the display to its normal orientation.

(Caution: sometimes display flipping (usually by accident) caused a display driver glitch which caused all Foldit clients to crash. This seems to have been fixed, probably on the Windows side, no recent incidents to report on.)

altejoh Lv 1

Have had a similar problem with all contact map puzzles. It is consistently caused by attempting to scroll to "zoom in" on the contact map, after which zooming out causes it to zoom back in once again. Figured it was another bug for Mac users. Also noticed that simply restarting the client and not scrolling on the contact map resolves the issue.

jeff101 Lv 1

I just tried the ctrl-alt-left arrow and ctrl-alt-up arrow trick Loci mentioned above. On a Dell Inspiron Windows 7 laptop, this trick let me rotate by 90 degrees an Internet Explorer window as well as a Foldit client window. In the rotated Foldit window, moving my mouse forward made the cursor move to the left, but I got used to this. I was able to shrink the enlarged Contact Map in this Foldit client without restarting the client, as desired.

Thanks!