Placeholder image of a protein
Icon representing a puzzle

1431: Unsolved De-novo Freestyle 117

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
September 16, 2017
Expires
Max points
100
Description

Note: In response to some player feedback related to the excessive size of this protein, we're extending the puzzle deadline by two weeks! The puzzle will expire on October 9 at 23:00 UTC.



Chikungunya (CHIK-un-goon-ya) virus (also known as CHIKV) is a mosquito-transmitted alphavirus that has spread around the world and is currently infecting people in about 60 countries globally. CHIKV is rarely fatal, but causes severe joint pain for months to years that can debilitate affected patients for long periods of time. There are currently no known drugs to treat CHIKV infection, primarily due to a lack of understanding of the structure of CHIKV proteins involved in viral genome replication. The Geiss lab has worked on developing drug targeting the membrane bound CHIKV nsP1 protein, which is the anchor for the viral genome replication complex on cellular membranes and a multifunctional enzyme that forms a 5’ RNA cap structure on the end of the CHIKV RNA genome. Solving the structure of the CHIKV nsP1 protein would provide critical information for designing drugs that inhibit nsP1 function and abort viral genome replication.


The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!


Note: Since the protein is huge for Foldit, we have divided the protein into two puzzles. This is the first puzzle.


Sequence:

MDPVYVDIDADSAFLKALQRAYPMFEVEPRQVTPNDHANARAFSHLAIKLIEQEIDPDSTILDIGSAPARRMMSDRKYHCVCPMRSAEDPERLANYARKLASAAGKVLDRNISGKIGDLQAVMAVPDTETPTFCLHTDVSCRQRADVAIYQDVYAVHAPTSLYHQAIKGVRVAYWVGFDTTPFMYNAMAGAYPSYSTNWADEQVLKAKNIGLCSTDLTEGRRGKLSIMRGKKLKPCDRVLFSV

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,229
  2. Avatar for Gargleblasters 2. Gargleblasters 84 pts. 10,065
  3. Avatar for Beta Folders 3. Beta Folders 70 pts. 10,023
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 58 pts. 10,017
  5. Avatar for Go Science 5. Go Science 48 pts. 9,891
  6. Avatar for Marvin's bunch 6. Marvin's bunch 39 pts. 9,887
  7. Avatar for Void Crushers 7. Void Crushers 32 pts. 9,882
  8. Avatar for Contenders 8. Contenders 26 pts. 9,250
  9. Avatar for Deleted group 9. Deleted group pts. 8,932
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 16 pts. 8,500

  1. Avatar for Already taken 141. Already taken Lv 1 4 pts. 5,318
  2. Avatar for mimajart 142. mimajart Lv 1 4 pts. 5,152
  3. Avatar for boondog 143. boondog Lv 1 4 pts. 5,142
  4. Avatar for mayday123 144. mayday123 Lv 1 4 pts. 5,129
  5. Avatar for A01632753 145. A01632753 Lv 1 3 pts. 5,087
  6. Avatar for Vincenzo Brancaccio 146. Vincenzo Brancaccio Lv 1 3 pts. 5,013
  7. Avatar for Anton Trikshev 147. Anton Trikshev Lv 1 3 pts. 5,010
  8. Avatar for jacalbr 148. jacalbr Lv 1 3 pts. 4,760
  9. Avatar for IntermolecularFolder 149. IntermolecularFolder Lv 1 3 pts. 4,699
  10. Avatar for altejoh 150. altejoh Lv 1 3 pts. 4,618

Comments


Timo van der Laan Lv 1

On such a big puzzle, it might be an idea to give us a few templates to work with. That might give us a chance to get to a structure that might be close.

Skippysk8s Lv 1

Just a note. I'd love to work this, but was out two days and don't have time to pull this together. sorry not to have more time, but little machine can't do this size puzzle in regular time period.
Maybe a little extra time for the next large puzzle would help
Skippy

Susume Lv 1

There are a few homolog (related) sequences that form real proteins but that match only segments 49-175 of our target protein, with one or both ends of our protein missing. I'm pretty sure that means segments 49-175 should be able to fold into a realistic protein shape without the ends being present. The ends would then add on without disrupting the shape of the middle section (and without depending on each other, since either end can be present while the other is absent). I have tried a couple of tracks where I fold 49-175 first, then add the ends on, and they seem to be working out well.

Bruno Kestemont Lv 1

Then for a following round, researchers could provide us with several templates for seg 49-175 (as suggested by Timo). It would help focusing.

lamoille Lv 1

Just asking, but is there an issue in scoring this puzzle ? It expired 12 hours ago and still no scores have been posted. Thanks for any feedback.