Placeholder image of a protein
Icon representing a puzzle

1442: Sketchbook Puzzle - Revisiting Puzzle 136

Closed since over 8 years ago

Intermediate Pilot

Summary


Created
October 20, 2017
Expires
Max points
100
Description

This small protein interferes with cellular adhesion and, consequently, clotting mechanisms. In this experimental puzzle you will have 250 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 2 pts. 8,244
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,192
  3. Avatar for Biochem-AD17 13. Biochem-AD17 1 pt. 8,176
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 7,999
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 7,929
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,809
  7. Avatar for GENE 433 17. GENE 433 1 pt. 7,648
  8. Avatar for D001x Med Chem MOOC 18. D001x Med Chem MOOC 1 pt. 7,631
  9. Avatar for Alpha Rays 19. Alpha Rays 1 pt. 6,640

  1. Avatar for Idiotboy 131. Idiotboy Lv 1 1 pt. 6,640
  2. Avatar for dettingen 132. dettingen Lv 1 1 pt. 6,640
  3. Avatar for maximiliancarey 133. maximiliancarey Lv 1 1 pt. 6,640
  4. Avatar for HarutB32 134. HarutB32 Lv 1 1 pt. 6,640

Comments