Placeholder image of a protein
Icon representing a puzzle

1442: Sketchbook Puzzle - Revisiting Puzzle 136

Closed since over 8 years ago

Intermediate Pilot

Summary

Created
October 20, 2017
Expires
Max points
100
Description

This small protein interferes with cellular adhesion and, consequently, clotting mechanisms. In this experimental puzzle you will have 250 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 2 pts. 8,244
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,192
  3. Avatar for Biochem-AD17 13. Biochem-AD17 1 pt. 8,176
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 7,999
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 7,929
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,809
  7. Avatar for GENE 433 17. GENE 433 1 pt. 7,648
  8. Avatar for D001x Med Chem MOOC 18. D001x Med Chem MOOC 1 pt. 7,631
  9. Avatar for Alpha Rays 19. Alpha Rays 1 pt. 6,640
  1. Avatar for smilingone 11. smilingone Lv 1 68 pts. 8,582
  2. Avatar for Bletchley Park 12. Bletchley Park Lv 1 65 pts. 8,581
  3. Avatar for Deleted player 13. Deleted player pts. 8,571
  4. Avatar for ViJay7019 14. ViJay7019 Lv 1 60 pts. 8,571
  5. Avatar for MicElephant 15. MicElephant Lv 1 58 pts. 8,567
  6. Avatar for fpc 16. fpc Lv 1 55 pts. 8,566
  7. Avatar for LavenderSky 17. LavenderSky Lv 1 53 pts. 8,558
  8. Avatar for tokens 18. tokens Lv 1 51 pts. 8,548
  9. Avatar for Blipperman 19. Blipperman Lv 1 49 pts. 8,547
  10. Avatar for georg137 20. georg137 Lv 1 47 pts. 8,544

Comments