Placeholder image of a protein
Icon representing a puzzle

1442: Sketchbook Puzzle - Revisiting Puzzle 136

Closed since over 8 years ago

Intermediate Pilot

Summary

Created
October 20, 2017
Expires
Max points
100
Description

This small protein interferes with cellular adhesion and, consequently, clotting mechanisms. In this experimental puzzle you will have 250 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,646
  2. Avatar for Contenders 2. Contenders 76 pts. 8,642
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 8,619
  4. Avatar for HMT heritage 4. HMT heritage 41 pts. 8,595
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,594
  6. Avatar for Beta Folders 6. Beta Folders 20 pts. 8,582
  7. Avatar for freefolder 7. freefolder 14 pts. 8,543
  8. Avatar for Marvin's bunch 8. Marvin's bunch 9 pts. 8,336
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 6 pts. 8,328
  10. Avatar for Richard Dawkins Foundation 10. Richard Dawkins Foundation 4 pts. 8,255
  1. Avatar for Hollinas
    1. Hollinas Lv 1
    100 pts. 8,646
  2. Avatar for toshiue 2. toshiue Lv 1 76 pts. 8,645
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 56 pts. 8,642
  4. Avatar for pauldunn 4. pauldunn Lv 1 41 pts. 8,640
  5. Avatar for Bletchley Park 5. Bletchley Park Lv 1 29 pts. 8,628
  6. Avatar for Galaxie 6. Galaxie Lv 1 20 pts. 8,594
  7. Avatar for ViJay7019 7. ViJay7019 Lv 1 14 pts. 8,592
  8. Avatar for smilingone 8. smilingone Lv 1 9 pts. 8,576
  9. Avatar for LociOiling 9. LociOiling Lv 1 6 pts. 8,567
  10. Avatar for georg137 10. georg137 Lv 1 4 pts. 8,563

Comments