Placeholder image of a protein
Icon representing a puzzle

1442: Sketchbook Puzzle - Revisiting Puzzle 136

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Pilot Pilot Pilot Pilot Pilot Pilot Pilot Pilot Pilot Pilot

Summary


Created
October 20, 2017
Expires
Max points
100
Description

This small protein interferes with cellular adhesion and, consequently, clotting mechanisms. In this experimental puzzle you will have 250 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups


  1. Avatar for Go Science 100 pts. 8,646
  2. Avatar for Contenders 2. Contenders 76 pts. 8,642
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 8,619
  4. Avatar for HMT heritage 4. HMT heritage 41 pts. 8,595
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,594
  6. Avatar for Beta Folders 6. Beta Folders 20 pts. 8,582
  7. Avatar for freefolder 7. freefolder 14 pts. 8,543
  8. Avatar for Marvin's bunch 8. Marvin's bunch 9 pts. 8,336
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 6 pts. 8,328

  1. Avatar for alwen 11. alwen Lv 1 2 pts. 8,560
  2. Avatar for Enzyme 12. Enzyme Lv 1 1 pt. 8,559
  3. Avatar for Deleted player 13. Deleted player pts. 8,555
  4. Avatar for alcor29 14. alcor29 Lv 1 1 pt. 8,551
  5. Avatar for isaksson 16. isaksson Lv 1 1 pt. 8,427
  6. Avatar for NinjaGreg 17. NinjaGreg Lv 1 1 pt. 8,418
  7. Avatar for puxatudo 18. puxatudo Lv 1 1 pt. 8,417
  8. Avatar for retiredmichael 19. retiredmichael Lv 1 1 pt. 8,413

Comments