Placeholder image of a protein
Icon representing a puzzle

1442: Sketchbook Puzzle - Revisiting Puzzle 136

Closed since over 8 years ago

Intermediate Intermediate Pilot Pilot

Summary


Created
October 20, 2017
Expires
Max points
100
Description

This small protein interferes with cellular adhesion and, consequently, clotting mechanisms. In this experimental puzzle you will have 250 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups


  1. Avatar for Go Science 100 pts. 8,646
  2. Avatar for Contenders 2. Contenders 76 pts. 8,642
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 8,619
  4. Avatar for HMT heritage 4. HMT heritage 41 pts. 8,595
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,594
  6. Avatar for Beta Folders 6. Beta Folders 20 pts. 8,582
  7. Avatar for freefolder 7. freefolder 14 pts. 8,543
  8. Avatar for Marvin's bunch 8. Marvin's bunch 9 pts. 8,336
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 6 pts. 8,328

  1. Avatar for crpainter
    1. crpainter Lv 1
    100 pts. 8,642
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 97 pts. 8,638
  3. Avatar for Enzyme 3. Enzyme Lv 1 93 pts. 8,619
  4. Avatar for toshiue 4. toshiue Lv 1 90 pts. 8,612
  5. Avatar for WBarme1234 5. WBarme1234 Lv 1 86 pts. 8,605
  6. Avatar for caglar 6. caglar Lv 1 83 pts. 8,600
  7. Avatar for O Seki To 7. O Seki To Lv 1 80 pts. 8,595
  8. Avatar for dizzywings 8. dizzywings Lv 1 77 pts. 8,594
  9. Avatar for Galaxie 9. Galaxie Lv 1 74 pts. 8,583
  10. Avatar for LociOiling 10. LociOiling Lv 1 71 pts. 8,582

Comments