Placeholder image of a protein
Icon representing a puzzle

1444: Unsolved De-novo Freestyle 119

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
October 30, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK

Top groups



  1. Avatar for Hollinas
    1. Hollinas Lv 1
    100 pts. 10,147
  2. Avatar for toshiue 2. toshiue Lv 1 87 pts. 10,146
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 75 pts. 10,146
  4. Avatar for ZeroLeak7 4. ZeroLeak7 Lv 1 64 pts. 10,145
  5. Avatar for Azukay 5. Azukay Lv 1 55 pts. 10,142
  6. Avatar for Deleted player 6. Deleted player pts. 10,115
  7. Avatar for isaksson 7. isaksson Lv 1 40 pts. 10,110
  8. Avatar for pauldunn 8. pauldunn Lv 1 33 pts. 10,090
  9. Avatar for Maerlyn138 9. Maerlyn138 Lv 1 28 pts. 10,089
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 23 pts. 10,079

Comments


Susume Lv 1

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!