Placeholder image of a protein
Icon representing a puzzle

1444: Unsolved De-novo Freestyle 119

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
October 30, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK

Top groups

  1. Avatar for BaconSBI4U septembre 2017 21. BaconSBI4U septembre 2017 1 pt. 4,380
  1. Avatar for pfirth 101. pfirth Lv 1 1 pt. 8,577
  2. Avatar for multaq 102. multaq Lv 1 1 pt. 8,540
  3. Avatar for Origami314 103. Origami314 Lv 1 1 pt. 8,532
  4. Avatar for ViJay7019 104. ViJay7019 Lv 1 1 pt. 8,515
  5. Avatar for Beta Helix 105. Beta Helix Lv 1 1 pt. 8,512
  6. Avatar for abiogenesis 106. abiogenesis Lv 1 1 pt. 8,499
  7. Avatar for nathanmills 107. nathanmills Lv 1 1 pt. 8,459
  8. Avatar for dbuske 108. dbuske Lv 1 1 pt. 8,427
  9. Avatar for sharondipity 109. sharondipity Lv 1 1 pt. 8,394
  10. Avatar for magneticflux 110. magneticflux Lv 1 1 pt. 8,298

Comments

Susume Lv 1

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!