Placeholder image of a protein
Icon representing a puzzle

1444: Unsolved De-novo Freestyle 119

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
October 30, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK

Top groups



  1. Avatar for TheStaticSloth 121. TheStaticSloth Lv 1 1 pt. 8,001
  2. Avatar for Arne Heessels 122. Arne Heessels Lv 1 1 pt. 7,938
  3. Avatar for demeter900 123. demeter900 Lv 1 1 pt. 7,913
  4. Avatar for Ladybug_dk 124. Ladybug_dk Lv 1 1 pt. 7,896
  5. Avatar for doctaven 125. doctaven Lv 1 1 pt. 7,839
  6. Avatar for bhfreagra 126. bhfreagra Lv 1 1 pt. 7,818
  7. Avatar for NotWeirdGifted 127. NotWeirdGifted Lv 1 1 pt. 7,795
  8. Avatar for DScott 128. DScott Lv 1 1 pt. 7,450
  9. Avatar for jo1sei 129. jo1sei Lv 1 1 pt. 7,442
  10. Avatar for isaacrubens 130. isaacrubens Lv 1 1 pt. 7,397

Comments


Susume Lv 1

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!