Placeholder image of a protein
Icon representing a puzzle

1444: Unsolved De-novo Freestyle 119

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
October 30, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK

Top groups



  1. Avatar for aguila5937 131. aguila5937 Lv 1 1 pt. 7,334
  2. Avatar for rezaefar 132. rezaefar Lv 1 1 pt. 7,201
  3. Avatar for Jspirit 133. Jspirit Lv 1 1 pt. 7,108
  4. Avatar for Petry 134. Petry Lv 1 1 pt. 7,097
  5. Avatar for pandapharmd 135. pandapharmd Lv 1 1 pt. 6,884
  6. Avatar for Deleted player 136. Deleted player pts. 6,871
  7. Avatar for emtonsti 137. emtonsti Lv 1 1 pt. 6,758
  8. Avatar for joekeller 138. joekeller Lv 1 1 pt. 6,467
  9. Avatar for 01010011111 139. 01010011111 Lv 1 1 pt. 6,316

Comments


Susume Lv 1

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!