Placeholder image of a protein
Icon representing a puzzle

1444: Unsolved De-novo Freestyle 119

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
October 30, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK

Top groups

  1. Avatar for BaconSBI4U septembre 2017 21. BaconSBI4U septembre 2017 1 pt. 4,380
  1. Avatar for Zinek 151. Zinek Lv 1 1 pt. 4,910
  2. Avatar for diegol77 152. diegol77 Lv 1 1 pt. 4,865
  3. Avatar for KaramSBI4U 153. KaramSBI4U Lv 1 1 pt. 4,380
  4. Avatar for livyatan0923 154. livyatan0923 Lv 1 1 pt. 4,299
  5. Avatar for eboppterp 155. eboppterp Lv 1 1 pt. 2,413
  6. Avatar for bkoep 156. bkoep Lv 1 1 pt. 0
  7. Avatar for pauldunn 157. pauldunn Lv 1 1 pt. 0
  8. Avatar for mgould2017 158. mgould2017 Lv 1 1 pt. 0
  9. Avatar for Bletchley Park 159. Bletchley Park Lv 1 1 pt. 0
  10. Avatar for Hollinas 160. Hollinas Lv 1 1 pt. 0

Comments

Susume Lv 1

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!