Placeholder image of a protein
Icon representing a puzzle

1444: Unsolved De-novo Freestyle 119

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
October 30, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK

Top groups

  1. Avatar for BaconSBI4U septembre 2017 21. BaconSBI4U septembre 2017 1 pt. 4,380
  1. Avatar for MadCat08 161. MadCat08 Lv 1 1 pt. 0
  2. Avatar for fabschreiber 162. fabschreiber Lv 1 1 pt. 0
  3. Avatar for tokens 163. tokens Lv 1 1 pt. 0
  4. Avatar for jesscross19600 164. jesscross19600 Lv 1 1 pt. 0
  5. Avatar for RNApolimerase 165. RNApolimerase Lv 1 1 pt. 0
  6. Avatar for Uttkarsh 166. Uttkarsh Lv 1 1 pt. 0
  7. Avatar for spvincent 167. spvincent Lv 1 1 pt. 0

Comments

Susume Lv 1

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!