Placeholder image of a protein
Icon representing a puzzle

1444: Unsolved De-novo Freestyle 119

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
October 30, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK

Top groups

  1. Avatar for BaconSBI4U septembre 2017 21. BaconSBI4U septembre 2017 1 pt. 4,380
  1. Avatar for LociOiling 11. LociOiling Lv 1 74 pts. 9,844
  2. Avatar for grogar7 12. grogar7 Lv 1 71 pts. 9,835
  3. Avatar for altejoh 13. altejoh Lv 1 69 pts. 9,755
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 67 pts. 9,724
  5. Avatar for jobo0502 15. jobo0502 Lv 1 65 pts. 9,722
  6. Avatar for eusair 16. eusair Lv 1 63 pts. 9,716
  7. Avatar for NinjaGreg 17. NinjaGreg Lv 1 61 pts. 9,716
  8. Avatar for actiasluna 18. actiasluna Lv 1 59 pts. 9,713
  9. Avatar for phi16 19. phi16 Lv 1 57 pts. 9,712
  10. Avatar for Skippysk8s 20. Skippysk8s Lv 1 55 pts. 9,688

Comments

Susume Lv 1

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!