Placeholder image of a protein
Icon representing a puzzle

1444: Unsolved De-novo Freestyle 119

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
October 30, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK

Top groups

  1. Avatar for BaconSBI4U septembre 2017 21. BaconSBI4U septembre 2017 1 pt. 4,380
  1. Avatar for georg137 51. georg137 Lv 1 17 pts. 9,351
  2. Avatar for cbwest 52. cbwest Lv 1 16 pts. 9,327
  3. Avatar for YeshuaLives 53. YeshuaLives Lv 1 16 pts. 9,312
  4. Avatar for jausmh 54. jausmh Lv 1 15 pts. 9,311
  5. Avatar for dpmattingly 55. dpmattingly Lv 1 14 pts. 9,302
  6. Avatar for TastyMunchies 56. TastyMunchies Lv 1 14 pts. 9,299
  7. Avatar for heather-1 57. heather-1 Lv 1 13 pts. 9,274
  8. Avatar for bzipitidoo 58. bzipitidoo Lv 1 13 pts. 9,268
  9. Avatar for KALDYH 59. KALDYH Lv 1 12 pts. 9,237
  10. Avatar for benrh 60. benrh Lv 1 12 pts. 9,225

Comments

Susume Lv 1

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!