Placeholder image of a protein
Icon representing a puzzle

1444: Unsolved De-novo Freestyle 119

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
October 30, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK

Top groups

  1. Avatar for BaconSBI4U septembre 2017 21. BaconSBI4U septembre 2017 1 pt. 4,380
  1. Avatar for rabamino12358 71. rabamino12358 Lv 1 7 pts. 9,081
  2. Avatar for ikalvet 72. ikalvet Lv 1 7 pts. 9,068
  3. Avatar for senor pit 73. senor pit Lv 1 6 pts. 9,042
  4. Avatar for Deleted player 74. Deleted player pts. 9,042
  5. Avatar for MicElephant 75. MicElephant Lv 1 6 pts. 9,023
  6. Avatar for jakestorm777 76. jakestorm777 Lv 1 5 pts. 9,002
  7. Avatar for fishercat 77. fishercat Lv 1 5 pts. 8,994
  8. Avatar for Maerlyn138 78. Maerlyn138 Lv 1 5 pts. 8,959
  9. Avatar for bcre8tvv 79. bcre8tvv Lv 1 5 pts. 8,958
  10. Avatar for Cyberkashi 80. Cyberkashi Lv 1 4 pts. 8,948

Comments

Susume Lv 1

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!