Placeholder image of a protein
Icon representing a puzzle

1444: Unsolved De-novo Freestyle 119

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
October 30, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK

Top groups



  1. Avatar for Jim Fraser 81. Jim Fraser Lv 1 4 pts. 8,913
  2. Avatar for Squirrely 82. Squirrely Lv 1 4 pts. 8,902
  3. Avatar for Vincera 83. Vincera Lv 1 4 pts. 8,888
  4. Avatar for momadoc 84. momadoc Lv 1 4 pts. 8,854
  5. Avatar for Azukay 85. Azukay Lv 1 3 pts. 8,839
  6. Avatar for toshiue 86. toshiue Lv 1 3 pts. 8,819
  7. Avatar for Merf 87. Merf Lv 1 3 pts. 8,816
  8. Avatar for Ben666 88. Ben666 Lv 1 3 pts. 8,773
  9. Avatar for hada 89. hada Lv 1 3 pts. 8,746
  10. Avatar for yorinagak 90. yorinagak Lv 1 3 pts. 8,733

Comments


Susume Lv 1

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!