Placeholder image of a protein
Icon representing a puzzle

1444: Unsolved De-novo Freestyle 119

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
October 30, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,148
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 10,013
  3. Avatar for Marvin's bunch 3. Marvin's bunch 60 pts. 10,011
  4. Avatar for Beta Folders 4. Beta Folders 45 pts. 9,982
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,879
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 24 pts. 9,841
  7. Avatar for Deleted group 7. Deleted group pts. 9,668
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,652
  9. Avatar for Contenders 9. Contenders 8 pts. 9,644
  10. Avatar for Deleted group 10. Deleted group pts. 9,416
  1. Avatar for frood66 11. frood66 Lv 1 19 pts. 10,011
  2. Avatar for Galaxie 12. Galaxie Lv 1 16 pts. 10,009
  3. Avatar for tamanrasset 13. tamanrasset Lv 1 13 pts. 10,006
  4. Avatar for Deleted player 14. Deleted player pts. 9,990
  5. Avatar for lamoille 15. lamoille Lv 1 8 pts. 9,989
  6. Avatar for phi16 16. phi16 Lv 1 7 pts. 9,986
  7. Avatar for alwen 17. alwen Lv 1 5 pts. 9,984
  8. Avatar for LociOiling 18. LociOiling Lv 1 4 pts. 9,982
  9. Avatar for alcor29 19. alcor29 Lv 1 3 pts. 9,967
  10. Avatar for grogar7 20. grogar7 Lv 1 2 pts. 9,964

Comments

Susume Lv 1

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!