Placeholder image of a protein
Icon representing a puzzle

1444: Unsolved De-novo Freestyle 119

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 30, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK

Top groups


  1. Avatar for Go Science 100 pts. 10,148
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 10,013
  3. Avatar for Marvin's bunch 3. Marvin's bunch 60 pts. 10,011
  4. Avatar for Beta Folders 4. Beta Folders 45 pts. 9,982
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,879
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 24 pts. 9,841
  7. Avatar for Deleted group 7. Deleted group pts. 9,668
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,652
  9. Avatar for Contenders 9. Contenders 8 pts. 9,644
  10. Avatar for Deleted group 10. Deleted group pts. 9,416

  1. Avatar for LociOiling 11. LociOiling Lv 1 74 pts. 9,844
  2. Avatar for grogar7 12. grogar7 Lv 1 71 pts. 9,835
  3. Avatar for altejoh 13. altejoh Lv 1 69 pts. 9,755
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 67 pts. 9,724
  5. Avatar for jobo0502 15. jobo0502 Lv 1 65 pts. 9,722
  6. Avatar for eusair 16. eusair Lv 1 63 pts. 9,716
  7. Avatar for NinjaGreg 17. NinjaGreg Lv 1 61 pts. 9,716
  8. Avatar for actiasluna 18. actiasluna Lv 1 59 pts. 9,713
  9. Avatar for phi16 19. phi16 Lv 1 57 pts. 9,712
  10. Avatar for Skippysk8s 20. Skippysk8s Lv 1 55 pts. 9,688

Comments


Susume Lv 1

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!