Placeholder image of a protein
Icon representing a puzzle

1461: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
December 19, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for GENE 433 11. GENE 433 1 pt. 8,722
  2. Avatar for Russian team 12. Russian team 1 pt. 8,656
  3. Avatar for BIP_2014 13. BIP_2014 1 pt. 8,544
  4. Avatar for freefolder 14. freefolder 1 pt. 8,495
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,495
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,422
  7. Avatar for D001x Med Chem MOOC 17. D001x Med Chem MOOC 1 pt. 8,067

  1. Avatar for blancamh 111. blancamh Lv 1 1 pt. 8,544
  2. Avatar for davidgn 112. davidgn Lv 1 1 pt. 8,540
  3. Avatar for martinf 113. martinf Lv 1 1 pt. 8,537
  4. Avatar for sciolizer 114. sciolizer Lv 1 1 pt. 8,536
  5. Avatar for andrewxc 115. andrewxc Lv 1 1 pt. 8,525
  6. Avatar for bergie72 116. bergie72 Lv 1 1 pt. 8,518
  7. Avatar for frostschutz 117. frostschutz Lv 1 1 pt. 8,513
  8. Avatar for NotJim99 118. NotJim99 Lv 1 1 pt. 8,510
  9. Avatar for momadoc 119. momadoc Lv 1 1 pt. 8,507
  10. Avatar for lconor 120. lconor Lv 1 1 pt. 8,502

Comments


toshiue Lv 1

Have been getting sporadic server errors when trying to DL shares on 1461. Such devolved into not showing any shares more recent than 36 hours ago. Closed all clients, rebooted machine, restarted all 1461 clients several times, tried on three different computers. Cannot read shares more recent than 36 hours ago. No one polled is saying they've had the same problem, but then none are saying they had success either. tosh