Placeholder image of a protein
Icon representing a puzzle

1461: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
December 19, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 8,722
  2. Avatar for Russian team 12. Russian team 1 pt. 8,656
  3. Avatar for BIP_2014 13. BIP_2014 1 pt. 8,544
  4. Avatar for freefolder 14. freefolder 1 pt. 8,495
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,495
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,422
  7. Avatar for D001x Med Chem MOOC 17. D001x Med Chem MOOC 1 pt. 8,067
  1. Avatar for eboppterp 131. eboppterp Lv 1 1 pt. 8,427
  2. Avatar for aspadistra 132. aspadistra Lv 1 1 pt. 8,422
  3. Avatar for Ricardo Oliveira 133. Ricardo Oliveira Lv 1 1 pt. 8,413
  4. Avatar for deathbat_87 134. deathbat_87 Lv 1 1 pt. 8,399
  5. Avatar for FloorV 135. FloorV Lv 1 1 pt. 8,399
  6. Avatar for harvardman 136. harvardman Lv 1 1 pt. 8,393
  7. Avatar for kimsejin5 137. kimsejin5 Lv 1 1 pt. 8,391
  8. Avatar for borenz1@hotmail.com 138. borenz1@hotmail.com Lv 1 1 pt. 8,351
  9. Avatar for majires 139. majires Lv 1 1 pt. 8,350
  10. Avatar for hpaege 140. hpaege Lv 1 1 pt. 8,337

Comments

toshiue Lv 1

Have been getting sporadic server errors when trying to DL shares on 1461. Such devolved into not showing any shares more recent than 36 hours ago. Closed all clients, rebooted machine, restarted all 1461 clients several times, tried on three different computers. Cannot read shares more recent than 36 hours ago. No one polled is saying they've had the same problem, but then none are saying they had success either. tosh