Placeholder image of a protein
Icon representing a puzzle

1461: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
December 19, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 8,722
  2. Avatar for Russian team 12. Russian team 1 pt. 8,656
  3. Avatar for BIP_2014 13. BIP_2014 1 pt. 8,544
  4. Avatar for freefolder 14. freefolder 1 pt. 8,495
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,495
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,422
  7. Avatar for D001x Med Chem MOOC 17. D001x Med Chem MOOC 1 pt. 8,067
  1. Avatar for Physott 141. Physott Lv 1 1 pt. 8,129
  2. Avatar for A_Pickle 142. A_Pickle Lv 1 1 pt. 8,126
  3. Avatar for 01010011111 143. 01010011111 Lv 1 1 pt. 8,074
  4. Avatar for talbers 144. talbers Lv 1 1 pt. 8,067
  5. Avatar for rainbowtrout 145. rainbowtrout Lv 1 1 pt. 8,000
  6. Avatar for VenomOwlish 146. VenomOwlish Lv 1 1 pt. 7,955
  7. Avatar for baiyuncanggou 147. baiyuncanggou Lv 1 1 pt. 7,955
  8. Avatar for Mike Cassidy 148. Mike Cassidy Lv 1 1 pt. 7,955
  9. Avatar for gulsahsimsir 149. gulsahsimsir Lv 1 1 pt. 7,955
  10. Avatar for mitup 150. mitup Lv 1 1 pt. 7,955

Comments

toshiue Lv 1

Have been getting sporadic server errors when trying to DL shares on 1461. Such devolved into not showing any shares more recent than 36 hours ago. Closed all clients, rebooted machine, restarted all 1461 clients several times, tried on three different computers. Cannot read shares more recent than 36 hours ago. No one polled is saying they've had the same problem, but then none are saying they had success either. tosh