Placeholder image of a protein
Icon representing a puzzle

1461: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
December 19, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 8,722
  2. Avatar for Russian team 12. Russian team 1 pt. 8,656
  3. Avatar for BIP_2014 13. BIP_2014 1 pt. 8,544
  4. Avatar for freefolder 14. freefolder 1 pt. 8,495
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,495
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,422
  7. Avatar for D001x Med Chem MOOC 17. D001x Med Chem MOOC 1 pt. 8,067
  1. Avatar for Deleted player 11. Deleted player pts. 8,820
  2. Avatar for DoctorSockrates 12. DoctorSockrates Lv 1 69 pts. 8,818
  3. Avatar for fiendish_ghoul 13. fiendish_ghoul Lv 1 67 pts. 8,816
  4. Avatar for smilingone 14. smilingone Lv 1 64 pts. 8,814
  5. Avatar for nicobul 15. nicobul Lv 1 62 pts. 8,811
  6. Avatar for Deleted player 16. Deleted player pts. 8,804
  7. Avatar for Museka 17. Museka Lv 1 58 pts. 8,798
  8. Avatar for frood66 18. frood66 Lv 1 56 pts. 8,797
  9. Avatar for Timo van der Laan 19. Timo van der Laan Lv 1 54 pts. 8,793
  10. Avatar for Flagg65a 20. Flagg65a Lv 1 52 pts. 8,792

Comments

toshiue Lv 1

Have been getting sporadic server errors when trying to DL shares on 1461. Such devolved into not showing any shares more recent than 36 hours ago. Closed all clients, rebooted machine, restarted all 1461 clients several times, tried on three different computers. Cannot read shares more recent than 36 hours ago. No one polled is saying they've had the same problem, but then none are saying they had success either. tosh