Placeholder image of a protein
Icon representing a puzzle

1461: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
December 19, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for Beta Folders 100 pts. 8,927
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 8,889
  3. Avatar for Go Science 3. Go Science 52 pts. 8,869
  4. Avatar for Gargleblasters 4. Gargleblasters 36 pts. 8,833
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 8,811
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 8,797
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 8,793
  8. Avatar for Contenders 8. Contenders 6 pts. 8,787
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 8,772
  10. Avatar for Deleted group 10. Deleted group pts. 8,730

  1. Avatar for Susume 151. Susume Lv 1 1 pt. 7,955
  2. Avatar for mitup 152. mitup Lv 1 1 pt. 7,955

Comments


toshiue Lv 1

Have been getting sporadic server errors when trying to DL shares on 1461. Such devolved into not showing any shares more recent than 36 hours ago. Closed all clients, rebooted machine, restarted all 1461 clients several times, tried on three different computers. Cannot read shares more recent than 36 hours ago. No one polled is saying they've had the same problem, but then none are saying they had success either. tosh