Placeholder image of a protein
Icon representing a puzzle

1461: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
December 19, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 8,927
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 8,889
  3. Avatar for Go Science 3. Go Science 52 pts. 8,869
  4. Avatar for Gargleblasters 4. Gargleblasters 36 pts. 8,833
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 8,811
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 8,797
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 8,793
  8. Avatar for Contenders 8. Contenders 6 pts. 8,787
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 8,772
  10. Avatar for Deleted group 10. Deleted group pts. 8,730
  1. Avatar for drjr 121. drjr Lv 1 1 pt. 8,499
  2. Avatar for leannerikicheever 122. leannerikicheever Lv 1 1 pt. 8,496
  3. Avatar for Altercomp 123. Altercomp Lv 1 1 pt. 8,495
  4. Avatar for Savas 124. Savas Lv 1 1 pt. 8,495
  5. Avatar for smais 125. smais Lv 1 1 pt. 8,493
  6. Avatar for xabxs 126. xabxs Lv 1 1 pt. 8,488
  7. Avatar for wouterenkinga 127. wouterenkinga Lv 1 1 pt. 8,461
  8. Avatar for zhao7162875 128. zhao7162875 Lv 1 1 pt. 8,459
  9. Avatar for ozanertekin 129. ozanertekin Lv 1 1 pt. 8,457
  10. Avatar for elcinelif 130. elcinelif Lv 1 1 pt. 8,442

Comments

toshiue Lv 1

Have been getting sporadic server errors when trying to DL shares on 1461. Such devolved into not showing any shares more recent than 36 hours ago. Closed all clients, rebooted machine, restarted all 1461 clients several times, tried on three different computers. Cannot read shares more recent than 36 hours ago. No one polled is saying they've had the same problem, but then none are saying they had success either. tosh