Placeholder image of a protein
Icon representing a puzzle

1462: Reindeer Beta-lactoglobulin

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
December 21, 2017
Expires
Max points
100
Description

This protein is a component of reindeer milk. Beta-lactoglobulin is a protein found in the milk of many mammals, including cows and sheep, but not in humans. Its natural function is still unknown. The structure of this protein was determined (with some difficulty) by x-ray crystallography in 2006. However, parts of the published structure are a little bit problematic. We want to see if Foldit players can fold this protein starting from an extended chain. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Note that, due to the large size of the protein, this puzzle will be active for two weeks.



Sequence:


IIVTQTMKDLDVQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPGGDLEILLQKWENGKCAQKKIIAEKTEIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEAMEKFDKALKALPMHIRLSFNPTQLEEQCRV

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 6 pts. 8,705
  2. Avatar for GENE 433 12. GENE 433 4 pts. 8,081
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 3 pts. 7,849
  4. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 6,961
  5. Avatar for Team South Africa 16. Team South Africa 1 pt. 5,932
  6. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,904
  7. Avatar for freefolder 18. freefolder 1 pt. 5,849
  8. Avatar for BCC 19. BCC 1 pt. 5,395
  9. Avatar for Deleted group 20. Deleted group pts. 4,791

  1. Avatar for Blipperman
    1. Blipperman Lv 1
    100 pts. 10,184
  2. Avatar for actiasluna 2. actiasluna Lv 1 84 pts. 10,183
  3. Avatar for eromana 3. eromana Lv 1 70 pts. 10,182
  4. Avatar for Skippysk8s 4. Skippysk8s Lv 1 58 pts. 10,181
  5. Avatar for andrewxc 5. andrewxc Lv 1 48 pts. 10,137
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 39 pts. 10,051
  7. Avatar for Paulo Roque 7. Paulo Roque Lv 1 32 pts. 10,048
  8. Avatar for smilingone 8. smilingone Lv 1 26 pts. 10,031
  9. Avatar for LociOiling 9. LociOiling Lv 1 20 pts. 10,031
  10. Avatar for toshiue 10. toshiue Lv 1 16 pts. 10,030

Comments


Susume Lv 1

I am confused about the disulfide bonus on 1462. There are 5 cysteines, at positions 66, 106, 119, 121, and 160. If two or four of these are involved in disulfide bonds, I would expect those two or four to be strongly conserved, that is, there would be cysteines in those spots in many related proteins, and a related protein that has one of the cysteines in a disulfide pair would almost always have the other as well.

Jpred finds 936 homologous sequences (related proteins) for our protein. Of those, 608 have a cys in position 66 - so that cys is strongly conserved. However, none of the others are conserved at anything like the same rate. At positions 106, 119, and 121, respectively, there are only 54, 30, and 6 related proteins that also have a cys there. None of those positions can be providing the selection pressure on position 66 to remain cysteine. 160 is more promising, with 234 related proteins having a cys there, but that's still not close to 608. This makes me wonder if there is some other molecule that residue 66 commonly forms a disulfide bond with, that provides the selection pressure to keep a cys in that spot. The other common AAs at that spot are K, G, Q, S, and N, suggesting that residue 66 is on the surface where it could interact with some other molecule.

Does this line of reasoning make any sense? Is it possible the disulfide is not within our protein but with some other molecule? Do you have some other reason to believe there is a disulfide within our protein?

dbuske Lv 1

I have made a fold just using the rama utility.
I moved the dots to red and green areas into small groups.
running wiggle here and there.
Dots would move to other colors at times which is fine.
Move dots, wiggle move dots, til finished.
I got perfect rama, but not folded up completely.
I doubt this would fold in the lab, but I wanted to
give it a try.

Bletchley Park Lv 1

The puzzle description does not mention at all that there is a 250 point bonus for making a disulfide bond !
I found out by accident…