Placeholder image of a protein
Icon representing a puzzle

1462: Reindeer Beta-lactoglobulin

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 21, 2017
Expires
Max points
100
Description

This protein is a component of reindeer milk. Beta-lactoglobulin is a protein found in the milk of many mammals, including cows and sheep, but not in humans. Its natural function is still unknown. The structure of this protein was determined (with some difficulty) by x-ray crystallography in 2006. However, parts of the published structure are a little bit problematic. We want to see if Foldit players can fold this protein starting from an extended chain. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Note that, due to the large size of the protein, this puzzle will be active for two weeks.



Sequence:


IIVTQTMKDLDVQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPGGDLEILLQKWENGKCAQKKIIAEKTEIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEAMEKFDKALKALPMHIRLSFNPTQLEEQCRV

Top groups


  1. Avatar for FoldIt@Netherlands 21. FoldIt@Netherlands 1 pt. 3,795
  2. Avatar for Eὕρηκα! Heureka! 22. Eὕρηκα! Heureka! 1 pt. 3,467
  3. Avatar for SR HMolec 23. SR HMolec 1 pt. 1,679
  4. Avatar for Deleted group 24. Deleted group pts. 0

  1. Avatar for Bletchley Park 21. Bletchley Park Lv 1 62 pts. 9,404
  2. Avatar for Glen B 22. Glen B Lv 1 60 pts. 9,369
  3. Avatar for christioanchauvin 23. christioanchauvin Lv 1 59 pts. 9,360
  4. Avatar for Vinara 24. Vinara Lv 1 57 pts. 9,356
  5. Avatar for reefyrob 25. reefyrob Lv 1 56 pts. 9,316
  6. Avatar for WBarme1234 26. WBarme1234 Lv 1 54 pts. 9,251
  7. Avatar for johnmitch 27. johnmitch Lv 1 53 pts. 9,244
  8. Avatar for MicElephant 28. MicElephant Lv 1 52 pts. 9,225
  9. Avatar for YeshuaLives 29. YeshuaLives Lv 1 50 pts. 9,133
  10. Avatar for TastyMunchies 30. TastyMunchies Lv 1 49 pts. 9,132

Comments


Hanto Lv 1

The puzzle description does not mention at all that there is a 250 point bonus for making a disulfide bond !
I found out by accident…

dbuske Lv 1

I have made a fold just using the rama utility.
I moved the dots to red and green areas into small groups.
running wiggle here and there.
Dots would move to other colors at times which is fine.
Move dots, wiggle move dots, til finished.
I got perfect rama, but not folded up completely.
I doubt this would fold in the lab, but I wanted to
give it a try.

Bletchley Park Lv 1

The puzzle description does not mention at all that there is a 250 point bonus for making a disulfide bond !
I found out by accident…