Placeholder image of a protein
Icon representing a puzzle

1465: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 2 pts. 9,798
  2. Avatar for GENE 433 12. GENE 433 1 pt. 9,297
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,050
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 8,903
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,839
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,778
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,754
  8. Avatar for Kentridge Biotech 18. Kentridge Biotech 1 pt. 7,931
  1. Avatar for martinf 101. martinf Lv 1 1 pt. 9,179
  2. Avatar for abiogenesis 102. abiogenesis Lv 1 1 pt. 9,174
  3. Avatar for pfirth 103. pfirth Lv 1 1 pt. 9,154
  4. Avatar for goldfish80 104. goldfish80 Lv 1 1 pt. 9,146
  5. Avatar for Merve Murat 105. Merve Murat Lv 1 1 pt. 9,127
  6. Avatar for Merf 106. Merf Lv 1 1 pt. 9,120
  7. Avatar for ozanertekin 107. ozanertekin Lv 1 1 pt. 9,086
  8. Avatar for senor pit 108. senor pit Lv 1 1 pt. 9,085
  9. Avatar for rinze 109. rinze Lv 1 1 pt. 9,058
  10. Avatar for xabxs 110. xabxs Lv 1 1 pt. 9,052

Comments