Placeholder image of a protein
Icon representing a puzzle

1465: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 2 pts. 9,798
  2. Avatar for GENE 433 12. GENE 433 1 pt. 9,297
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,050
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 8,903
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,839
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,778
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,754
  8. Avatar for Kentridge Biotech 18. Kentridge Biotech 1 pt. 7,931
  1. Avatar for Savas 111. Savas Lv 1 1 pt. 9,050
  2. Avatar for leannerikicheever 112. leannerikicheever Lv 1 1 pt. 9,041
  3. Avatar for hada 113. hada Lv 1 1 pt. 9,038
  4. Avatar for Wheeler22 114. Wheeler22 Lv 1 1 pt. 9,037
  5. Avatar for gstelle 115. gstelle Lv 1 1 pt. 9,030
  6. Avatar for Deleted player 116. Deleted player pts. 9,030
  7. Avatar for momadoc 117. momadoc Lv 1 1 pt. 9,029
  8. Avatar for Dijkgraaf 118. Dijkgraaf Lv 1 1 pt. 9,029
  9. Avatar for multaq 119. multaq Lv 1 1 pt. 9,024
  10. Avatar for Knoblerine 120. Knoblerine Lv 1 1 pt. 9,016

Comments