Placeholder image of a protein
Icon representing a puzzle

1465: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
January 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 2 pts. 9,798
  2. Avatar for GENE 433 12. GENE 433 1 pt. 9,297
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,050
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 8,903
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,839
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,778
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,754
  8. Avatar for Kentridge Biotech 18. Kentridge Biotech 1 pt. 7,931

  1. Avatar for gulsahsimsir 141. gulsahsimsir Lv 1 1 pt. 8,758
  2. Avatar for alyssa_d 142. alyssa_d Lv 1 1 pt. 8,754
  3. Avatar for lamoille 143. lamoille Lv 1 1 pt. 8,750
  4. Avatar for 402-Ri_Fed 144. 402-Ri_Fed Lv 1 1 pt. 8,663
  5. Avatar for tigerdwgth 145. tigerdwgth Lv 1 1 pt. 8,379
  6. Avatar for claudiu.avram 146. claudiu.avram Lv 1 1 pt. 8,353
  7. Avatar for sendasticloop 147. sendasticloop Lv 1 1 pt. 8,233
  8. Avatar for 01010011111 148. 01010011111 Lv 1 1 pt. 8,055
  9. Avatar for Dilara Caliskur 149. Dilara Caliskur Lv 1 1 pt. 8,039
  10. Avatar for P-51 Mustang 150. P-51 Mustang Lv 1 1 pt. 8,028

Comments