Placeholder image of a protein
Icon representing a puzzle

1465: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 2 pts. 9,798
  2. Avatar for GENE 433 12. GENE 433 1 pt. 9,297
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,050
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 8,903
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,839
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,778
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,754
  8. Avatar for Kentridge Biotech 18. Kentridge Biotech 1 pt. 7,931
  1. Avatar for altejoh 31. altejoh Lv 1 35 pts. 10,230
  2. Avatar for Deleted player 32. Deleted player 33 pts. 10,227
  3. Avatar for Museka 33. Museka Lv 1 32 pts. 10,224
  4. Avatar for crpainter 34. crpainter Lv 1 31 pts. 10,219
  5. Avatar for WBarme1234 35. WBarme1234 Lv 1 29 pts. 10,204
  6. Avatar for pvc78 36. pvc78 Lv 1 28 pts. 10,194
  7. Avatar for stomjoh 37. stomjoh Lv 1 27 pts. 10,192
  8. Avatar for Glen B 38. Glen B Lv 1 26 pts. 10,178
  9. Avatar for eromana 39. eromana Lv 1 25 pts. 10,171
  10. Avatar for Tehnologik1 40. Tehnologik1 Lv 1 24 pts. 10,164

Comments