Placeholder image of a protein
Icon representing a puzzle

1465: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 2 pts. 9,798
  2. Avatar for GENE 433 12. GENE 433 1 pt. 9,297
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,050
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 8,903
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,839
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,778
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,754
  8. Avatar for Kentridge Biotech 18. Kentridge Biotech 1 pt. 7,931
  1. Avatar for christioanchauvin 41. christioanchauvin Lv 1 23 pts. 10,155
  2. Avatar for jobo0502 42. jobo0502 Lv 1 22 pts. 10,154
  3. Avatar for Vinara 43. Vinara Lv 1 21 pts. 10,152
  4. Avatar for Idiotboy 44. Idiotboy Lv 1 20 pts. 10,145
  5. Avatar for YeshuaLives 45. YeshuaLives Lv 1 19 pts. 10,105
  6. Avatar for diamonddays 46. diamonddays Lv 1 19 pts. 10,104
  7. Avatar for Anfinsen_slept_here 47. Anfinsen_slept_here Lv 1 18 pts. 10,096
  8. Avatar for isaksson 48. isaksson Lv 1 17 pts. 10,091
  9. Avatar for jausmh 49. jausmh Lv 1 16 pts. 10,075
  10. Avatar for MicElephant 50. MicElephant Lv 1 15 pts. 10,057

Comments