Placeholder image of a protein
Icon representing a puzzle

1465: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
January 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 2 pts. 9,798
  2. Avatar for GENE 433 12. GENE 433 1 pt. 9,297
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,050
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 8,903
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,839
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,778
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,754
  8. Avatar for Kentridge Biotech 18. Kentridge Biotech 1 pt. 7,931

  1. Avatar for georg137 51. georg137 Lv 1 15 pts. 10,053
  2. Avatar for robgee 52. robgee Lv 1 14 pts. 10,051
  3. Avatar for fpc 53. fpc Lv 1 13 pts. 10,049
  4. Avatar for tarimo 54. tarimo Lv 1 13 pts. 10,048
  5. Avatar for Sissue 55. Sissue Lv 1 12 pts. 10,038
  6. Avatar for smilingone 56. smilingone Lv 1 12 pts. 10,034
  7. Avatar for katling 57. katling Lv 1 11 pts. 10,028
  8. Avatar for alwen 58. alwen Lv 1 11 pts. 10,026
  9. Avatar for andrewxc 59. andrewxc Lv 1 10 pts. 9,986
  10. Avatar for dbuske 60. dbuske Lv 1 10 pts. 9,982

Comments